PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29822.m003439
Common NameRCOM_0853240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MYB_related
Protein Properties Length: 286aa    MW: 31304.4 Da    PI: 4.604
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29822.m003439genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.62.9e-081445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     rg W++eEd +++ +v  +G g+W++++++ g
    29822.m003439 14 RGLWSAEEDAKILAYVSNHGIGNWTLVPKKAG 45
                     788**************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-11543IPR009057Homeodomain-like
SuperFamilySSF466896.65E-8852IPR009057Homeodomain-like
PROSITE profilePS500906.69943IPR017877Myb-like domain
PfamPF002497.1E-61445IPR001005SANT/Myb domain
CDDcd001671.43E-41745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWSAE EDAKILAYVS NHGIGNWTLV PKKAGIDPVT HKPFSQILSD  60
YGNISGIINS GNPIGSFNKF LNNNSNTNNL IPKPEPSSVL TGPSSSNKIL APSSLEQQVQ  120
DNHPPWNLLP QFQFANHDIM QPHFFSEVSS SCSSSSSTTL TQLNSPRSYS CQQSQPPTTP  180
SPCLWSEFLV SDPALSADFQ QQQQQENDSN GRVSSLTLDE KHISHDKFGD GNEGFGSYED  240
RGTINGSQAN TDISPCSATS FLDGILDKDR EMSLQFPELL DISFDY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015573637.11e-152PREDICTED: transcription factor MYB35
TrEMBLB9RUJ10.0B9RUJ1_RICCO; R2r3-myb transcription factor, putative
STRINGVIT_14s0066g02180.t019e-38(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-23MYB family protein